- eIF2B3 Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-83986
- eIF2B3
- EIF-2B, EIF2Bgamma, VWM3
- Unconjugated
- PBS (pH 7.2) and 40% Glycerol
- Western Blot, Immunohistochemistry, Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin
- This antibody was developed against Recombinant Protein corresponding to amino acids: KEANTLNLAP YDACWNACRG DRWEDLSRSQ VRCYVHIMKE GLCSRVSTLG LYMEANRQVP KLLSALCPEE PPVHSSAQIV SKHLVG
- Rabbit
- Human
- 0.1 ml (also 25ul)
- eukaryotic translation initiation factor 2B subunit gamma
- IgG
- Polyclonal
- Immunogen affinity purified
- Novus Biologicals, a Bio-Techne Brand
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
KEANTLNLAPYDACWNACRGDRWEDLSRSQVRCYVHIMKEGLCSRVSTLGLYMEANRQVPKLLSALCPEEPPVHSSAQIVSKHLVG
Specifications/Features
Available conjugates: Unconjugated